RUVBL2 Rabbit Polyclonal Antibody

• Catalog Number: orb574170
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RUVBL2
• Target: RUVBL2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2
• Protein Sequence: Synthetic peptide located within the following region: IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID
• UniProt ID: Q9Y230
• MW: 51kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J,
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_006657

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Human Liver

Rabbit Anti-RUVBL2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RUVBL2 Antibody, Positive Control: Lane 1: 30 ug K562 lysate, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:1000.

WB Suggested Anti-RUVBL2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.