RUVBL2 Rabbit Polyclonal Antibody

• Catalog Number: orb574169
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RUVBL2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: RUVBL2
• UniProt ID: Q9Y230
• Protein Sequence: Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI
• NCBI: NP_006657
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Lung

Human urinary bladder

Sample Type: Lane 1: 20 ug untransfected H1299 cells, Lane 2: 20 ug siRUVBL2 transfected H1299 cells Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:3000 Color/Signal Descriptions: RUVBL2.

WB Suggested Anti-RUVBL2 Antibody Titration: 2.0-4.0 ug/ml, Positive Control: Daudi cell lysate, RUVBL2 is supported by BioGPS gene expression data to be expressed in Daudi.