RUNX1T1 Rabbit Polyclonal Antibody

• Catalog Number: orb583881
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RUNX1T1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RUNX1T1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: RUNX1T1
• UniProt ID: B2R6I9
• Protein Sequence: Synthetic peptide located within the following region: CGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTP
• NCBI: NP_004340
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CDR, ETO, MTG8, AML1T1, ZMYND2, CBFA2T1, AML1-MTG8
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

RUNX1T1 antibody - middle region (orb583881), Catalog Number: orb583881, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Nucleus in hepatocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RUNX1T1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.