RUNX1T1 Rabbit Polyclonal Antibody

• Catalog Number: orb574900
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RUNX1T1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RUNX1T1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68kDa
• Target: RUNX1T1
• UniProt ID: Q06455
• Protein Sequence: Synthetic peptide located within the following region: LHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAI
• NCBI: NP_783554
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CDR, ETO, MTG8, AML1T1, ZMYND2, CBFA2T1, AML1-MTG8
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. RUNX1T1 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-RUNX1T1 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate, There is BioGPS gene expression data showing that RUNX1T1 is expressed in HepG2.