You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326118 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RTCB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C22orf28 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | RTCB |
UniProt ID | Q9Y3I0 |
Protein Sequence | Synthetic peptide located within the following region: EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC |
NCBI | NP_055121 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DJ149A16.6 antibody, anti HSPC117 antibody, a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Hela tissue using RTCB antibody
Western blot analysis of MCF7 cell lysate tissue using RTCB antibody
Western blot analysis of human Jurkat tissue using RTCB antibody
Western blot analysis of human 721_B tissue using RTCB antibody
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating