C22orf28 Rabbit Polyclonal Antibody

• Catalog Number: orb326117
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RTCB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf28
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55 kDa
• Target: RTCB
• UniProt ID: Q9Y3I0
• Protein Sequence: Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
• NCBI: NP_055121
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DJ149A16.6 antibody, anti HSPC117 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be modified by phosphorylation.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, RTCB is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, RTCB is supported by BioGPS gene expression data to be expressed in Jurkat.

Rabbit Anti-C22orf28 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 10 ug/mL.

Rabbit Anti-C22orf28 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 10 ug/mL.

Rabbit Anti-RTCB Antibody, Catalog Number: orb326117, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-C22orf28 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.