RPLP0 Rabbit Polyclonal Antibody

• Catalog Number: orb577494
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPLP0
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPLP0
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: RPLP0
• UniProt ID: P05388
• Protein Sequence: Synthetic peptide located within the following region: TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT
• NCBI: NP_000993
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P0, LP0, L10E, RPP0, PRLP0
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-RPLP0 Antibody, Catalog Number: orb577494, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RPLP0 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. RPLP0 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.