RPLP0 Rabbit Polyclonal Antibody

• Catalog Number: orb577495
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPLP0
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPLP0
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: RPLP0
• UniProt ID: P05388
• Protein Sequence: Synthetic peptide located within the following region: PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY
• NCBI: NP_000993
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P0, LP0, L10E, RPP0, PRLP0
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-RPLP0 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate. RPLP0 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.