RORC antibody

• Catalog Number: orb329708
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Equine, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RORC
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: RORC
• UniProt ID: B3KUU9
• Protein Sequence: Synthetic peptide located within the following region: CHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPD
• NCBI: NP_001001523
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC129539 antibody, anti NR1F3 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Placenta tissue using RORC antibody

Western blot analysis of Transfected 293T tissue using RORC antibody

Western blot analysis of human Placenta tissue using RORC antibody

Western blot analysis of human Fetal Muscle tissue using RORC antibody