RORC Rabbit Polyclonal Antibody

• Catalog Number: orb331020
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORC
• Target: RORC
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORC
• Protein Sequence: Synthetic peptide located within the following region: KICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN
• UniProt ID: P51449
• MW: 56kDa
• Tested applications: IHC-P, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MGC129539 antibody, anti NR1F3 antibody, anti
• Note: For research use only
• NCBI: NP_001001523

Human Testis

Human Testis

WB Suggested Anti-RORC Antibody Titration: 1 ug/ml, Positive Control: Fetal Brain Lysate.