RNF5 Rabbit Polyclonal Antibody

• Catalog Number: orb583906
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RNF5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 20kDa
• Target: RNF5
• UniProt ID: Q99942
• Protein Sequence: Synthetic peptide located within the following region: AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL
• NCBI: NP_008844
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RMA1, RING5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): HepG2 cell lysate (HG), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 1 ug/ml.

WB Suggested Anti-RNF5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Hela cell lysate. RNF5 is supported by BioGPS gene expression data to be expressed in HeLa.