You have no items in your shopping cart.
RHD Antibody
SKU: orb675977
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 2
| Tested Applications | ELISA, WB |
|---|---|
| Dilution Range | WB: 1:500-1:2000, ELISA: 1:10000 |
| Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Synthesized peptide derived from the Internal region of Human CD240d (161-210aa) : FNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAM. |
| Target | RHD |
| Purification | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | Liquid in PBS containing 50% glycerol, 0.5% rAlbumin and 0.02% sodium azide. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Anti-RHD antibody, anti-Blood group Rh(D) polypeptide antibody, anti-RHXIII antibody, anti-Rh polypeptide 2 antibody, anti-RhPII antibody, anti-Rhesus D antigen antibody, anti-CD240D antibody
Similar Products
−CD240d rabbit pAb Antibody [orb767231]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of mouse brain cells using RHD antibody

Western blot analysis of MOUSE-BRAIN cells using RHD antibody
Quick Database Links
Gene Symbol
RHD
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
RHD Antibody (orb675977)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











