You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
RHD Rabbit Polyclonal Antibody
Catalog Number: orb585524
| Catalog Number | orb585524 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RHD |
| Target | RHD |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: WALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFL |
| UniProt ID | Q5XLT3 |
| MW | 35kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | RH, Rh4, RH30, RhII, RhPI, DIIIc, RHCED, RHDel, RH Read more... |
| Note | For research use only |
| NCBI | NP_001121163 |
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-RHD Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. RHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
- Item 1 of 5
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
Anti-CD240d Antibody [orb382516]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 2
