RHCG Rabbit Polyclonal Antibody

• Catalog Number: orb578482
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RHCG
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53 kDa
• Target: RHCG
• UniProt ID: Q9UBD6
• Protein Sequence: Synthetic peptide located within the following region: NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL
• NCBI: NP_057405
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RHGK, PDRC2, C15orf6, SLC42A3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-RHCG antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-RHCG antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 3 ug/ml.