You have no items in your shopping cart.
RHCG Rabbit Polyclonal Antibody
SKU: orb578481
Description
Research Area
Epigenetics
Images & Validation
−Item 1 of 1
| Tested Applications | IHC |
|---|---|
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC |
| Target | RHCG |
| Molecular Weight | 53 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Disclaimer | For research use only |
Alternative Names
−RHGK, PDRC2, C15orf6, SLC42A3
Similar Products
−- Item 1 of 5
- Item 1 of 3
RhCG rabbit pAb Antibody [orb766693]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 3
- Item 1 of 2
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Rabbit Anti-RHCG antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Documents Download
Datasheet
Product Information
Request a Document
RHCG Rabbit Polyclonal Antibody (orb578481)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 3-7 working days