Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Description

Apolipoprotein A1 (ApoA-I) mimetic, improves glucose clearance and control; Peptides.

Images & Validation

Key Properties

MW3790.41 Da
Purity> 95% by HPLC
FormulaC175H282N42O51
Protein SequenceAc-Pro-Ala-Leu-Glu-Asp-Leu-Arg-Gln-Gly-Leu-Leu-Pro-Val-Leu-Glu-Ser-Phe-Lys-Val-Ser-Phe-Leu-Ser-Ala-Leu-Glu-Glu-Tyr-Thr-Lys-Lys-Leu-Asn-NH2

Storage & Handling

StorageStore desiccated, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Ac-PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN-NH2, ApoA-IGH220, PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN, RG33, amino acid residues 209-241 of apolipoprotein A1, lipid metabolism

Similar Products

  • RG33 Peptide [orb1943478]

    5 mg, 50 mg
  • RG33 TFA [orb1980046]

    3790.36

    500 μg, 1 mg, 5 mg, 10 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 390.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry