You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Reptile TLF1 protein
Catalog Number: orb604721
| Catalog Number | orb604721 |
|---|---|
| Category | Proteins |
| Description | Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin(TLF1) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P05620 |
| MW | 33.1 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) |
| Expression Region | 25-260aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Fibrinogen-clotting enzyme (Habutobin) (Snake veno Read more... |
| Research Area | Epigenetics |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) TLF1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) TLF1.
