RecombinantNOV,Human

SKU: orb1494672

Description

Nephroblastoma Overexpressed Gene Protein (NOV), also known as CCN3, IGFBP9 and NOVH, is one of the CCN family of secreted proteins. It is expressed in bone marrow, thymic cells and nephroblastoma. NOV signals through integrin receptors, NOTCH1 and fibulin 1c to regulate multiple cellular activities, such as cell adhesion, migration, proliferation and differentiation. The reported functions of NOV are diverse. It has been reported to play a role in angiogenesis and stem cell self-renewal. It has also been implicated in osteogenic differentiation, embryo development and cancer pathogenesis.

Images & Validation

• Application Notes:
  Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

• Source: CHO
• Biological Activity: ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.
• Molecular Weight: 20-50 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCV FDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRP EATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSL KAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELK TTRGKM
• Purification: > 95% as analyzed by SDS-PAGE and HPLC.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.

Storage & Handling

• Storage: Lyophilized recombinant Human NOV remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human NOV should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Nephroblastoma Overexpressed gene, CCN3, IGFBP9, NovH