RecombinantMIP-1α/CCL3,Mouse

SKU: orb1494631

Description

MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1α belongs to the CCL chemokine family, and shares 68% homology with MIP-1β. The mature form of MIP-1α contains 69 amino acids, exists as dimers in solution, and tends to undergo reversible aggregation. The receptors of MIP-1αin vivo are mainly the G-protein coupled receptors CCR1 and CCR5. Upon stimulation by endogenous and exogenous agents such as Interleukin-1β, Interferon-γ, and lipoteichoic acid from gram-positive bacteria, monocytes are able to secrete significant amounts of MIP-1α. MIP-1α augments the adhesions of T lymphocytes, monocytes, and neutrophils to vascular cell adhesion molecule 1. Additionally, in wounds, MIP-1αchemoattracts macrophages in order to accelerate the tissue repair process.Recombinant Mouse MIP-1 alpha/CCL3 (rmMIP-1α) produced in HEK 293cells is a single polypeptide chain containing 69 amino acids. A fully biologically active molecule, rmMIP-1αhas a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Images & Validation

• Application Notes:
  Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

• Source: HEK 293
• Biological Activity: The EC50 value of mouse MIP-1α/CCL3 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCCR1 cells (human Gα15 and mouse CCR1 stably expressed in CHO-K1 cells) is less than 100 ng/ml.
• Molecular Weight: 7.8 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
• Purification: > 95% as analyzed by SDS-PAGE and HPLC.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.

Storage & Handling

• Storage: Lyophilized recombinant Mouse MIP-1α/CCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution Mouse MIP-1α/CCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Disclaimer: For research use only

Alternative Names

MIP1α; Macrophage Inflammatory Protein-1α, CCL3, LD78α