RecombinantMIP-1α/CCL3,Human(CHO-expressed)

SKU: orb1494681

Description

MIP-1 Alpha, also known as CCL3, G0S19-1 and SCYA3, is a small inducible monokine belonging to the intercrine beta (chemokine CC) family. It binds to CCR1, CCR4 and CCR5, and participates in the host response to invading pathogens by regulating the trafficking and activation of inflammatory cells, such as macrophages, lymphocytes, NK cells and dendritic cells. MIP-1 alpha polymorphisms are associated with HIV susceptibility or resistance. Recombinant MIP-1 alpha induces a dose-dependent inhibition of HIV and SIV infection.

Images & Validation

• Application Notes:
  Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

• Source: CHO
• Biological Activity: ED50 < 100 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells expressing CCR5.
• Purification: > 95% as analyzed by SDS-PAGE and HPLC.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• MW: 8-10 kDa, observed by reducing SDS-PAGE.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Protein Sequence: ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Storage & Handling

• Storage: Lyophilized recombinant Human MIP-1 Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1 Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MIP1α; Macrophage Inflammatory Protein-1α, CCL3, LD78α