You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | HEK 293 |
|---|---|
| Biological Activity | The EC50 value of human I‑TAC/CXCL11 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR3 cells (human Ga15 and human CXCR3 stably expressed in CHO-K1 cells) is less than 0.5 μg/ml. |
| Purification | > 98% as analyzed by SDS-PAGE. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| MW | 8.3 kDa, observed by reducing SDS-PAGE. |
| Purity | > 98% as analyzed by SDS-PAGE. |
| Protein Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQ ARLIIKKVERKNF |
Storage & Handling
−| Storage | Lyophilized recombinant humanI‑TAC/ CXCL11 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, humanCXCL11/I‑TAC should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ITAC, CXCL11

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
RecombinantI‑TAC/CXCL11,Human(HEK293-expressed) (orb1494634)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review