RecombinantIL-10,Human(CHO-expressed)

SKU: orb1494723

Description

Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells, and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and Th2 cells. It also displays ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.

Images & Validation

• Application Notes:
  Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

• Source: CHO
• Biological Activity: ED50 < 0.2 ng/ml, measured in a cell proliferation assay using MC/9 cells.
• Molecular Weight: 18-19 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQA ENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
• Purification: > 95% as analyzed by SDS-PAGE and HPLC.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.

Storage & Handling

• Storage: Lyophilized recombinant Human Interleukin-10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Disclaimer: For research use only

Alternative Names

Interleukin-10, IL10