RecombinantENA-78/CXCL5,Human(HEK293-expressed)

SKU: orb1494651

Description

Epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of ENA-78 has also been observed in eosinophils, and can be inhibited with the type II interferon,IFN-γ. ENA-78 stimulates the chemotaxis of neutrophils possessing angiogenic properties. It plays a role in reducing sensitivity to sunburn pain in some subjects, and could be a potential target used to understand more about pain in other inflammatory conditions. ENA-78 is well known to have chemotactic and activating functions on neutrophils, mainly during acute inflammatory responses. It can signal through the CXCR2 receptor.Recombinant ENA-78/CXCL5 produced in 293 cells is a single polypeptide chain containing 78 amino acids. rhENA-78/CXCL5 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Images & Validation

• Application Notes:
  Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

• Source: HEK 293
• Biological Activity: The EC50 value of human ENA-78/CXCL5 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml.
• Molecular Weight: 8.5 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA PFLKKVIQKILDGGNKEN
• Purification: > 98% as analyzed by SDS-PAGE.
• Purity: > 98% as analyzed by SDS-PAGE.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.

Storage & Handling

• Storage: Lyophilized recombinant human ENA-78°CXCL5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human ENA-78°CXCL5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Disclaimer: For research use only

Alternative Names

Epithelial Neutrophil Activating Peptide-78, CXCL5