You have no items in your shopping cart.
Recombinant Vibrio cholerae serotype O1 Toxin coregulated pilus biosynthesis outer membrane protein C(tcpC)
SKU: orb2914120
Description
Research Area
Infectious Disease & Virology; Cell Biology
Images & Validation
−
Key Properties
−| Biological Origin | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
|---|---|
| Expression Region | 17-489 |
| Protein Length | full length protein |
| Protein Sequence | CSNTNLLKDNLASEQSVINLSKSSNEAKSRNIEFLSGAYLSERKVPKHDIKFSGKYVEFE SKSPIELIDVLDGLSKQYNIQYVFSDELEDENSEENKKSSGSSSAKKIKYSGPLAGFFDY LSSAYNMHFEFGHNNLVKAYHYKNQVFNLQQYFDDNKFSSSMQIGGTSGTSSGLKGTADT AIESNSWEKIDEFLSASLGETGKFTIFEDYSLVTVKARPDKFLLLHTFFDKLINESKMQI AVDYRVVSLSEERLNQLAAKFGIENAGKYSITSDMVDAISLSQVGGGLGASYRSASARLD AVVNELSQEVMHEGHFIGIPNRVMPLNVTTNSKYISSIETTKDTNTDEETRTVKVSDLVT GFSMMVMPKILDDGRIQISSGFSRKQLVSIGTAQGITLPTVDENESMNTVTMNPGEVRLA MLFKDNYIQNSNGVQLLGGGTENKKSARYIAVLVGASSYKTNDLASNRVNIYD |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Toxin coregulated pilus biosynthesis outer membrane protein C, TCP pilus biosynthesis protein tcpC
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 15-40 working days