You have no items in your shopping cart.
Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB(porB)
SKU: orb1647789
Description
Research Area
Cell Biology
Images & Validation
−
Key Properties
−| Expression System | E.coli |
|---|---|
| Immunogen | DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF |
| Tag | N-terminal 6xHis-SUMO-tagged |
| MW | 49.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Tris-based buffer 50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide