You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb623196 |
---|---|
Category | Proteins |
Description | Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast. |
Form/Appearance | Lyophilized |
MW | 17.3 kDa |
Protein Sequence | LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156) |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Application notes | The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control. |
Expiration Date | 6 months from date of receipt. |
Greater than 95% as determined by SDS-PAGE. | |
16.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
35.7 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
23.6 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
23.8 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |