Recombinant Mouse IL-6

SKU: orb623197

Description

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Images & Validation

−

Application Notes	The Mouse IL-10 protein can be used in cell culture, as an IL-10 ELISA Standard, and as a Western Blot Control.

Key Properties

−

Source	Yeast
Molecular Weight	21.7 kDa
Protein Sequence	FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Disclaimer	For research use only

Similar Products

−

Mouse IL-6 [orb2994610]

Conjugation:	Unconjugated
Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
MW:	Predicted: 21.8 KDa. Observed: 22 KDa, reducing conditions

Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg

Item 1 of 2
Recombinant mouse IL-6 protein, C-His [orb1516900]
Purity:
>95% as determined by SDS-PAGE
MW:
26 kDa
Sizes Available: 100 μg, 500 μg, 20 μg

Item 1 of 1

Mouse IL6 Protein, hFc Tag [orb1826783]

Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 47.9 kDa after removal of the signal peptide. The apparent molecular mass of mIL6-hFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Recombinant Mouse IL6 Protein, C-His [orb2969495]
Purity:
>90% as determined by SDS-PAGE.
MW:
22.84 kDa
Sizes Available: 1 mg, 100 μg, 50 μg
Recombinant Mouse IL6 Protein, C-Strep [orb2964792]
Purity:
>90% as determined by SDS-PAGE.
MW:
25.26 kDa
Sizes Available: 1 mg, 100 μg, 50 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols