Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Mouse IL-10

SKU: orb623198

Description

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
MW18.8 kDa
Protein SequenceSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Recombinant Mouse IL-22 Protein [orb2994339]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 43.8 KDa. Observed: 50-65 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Mouse IL-22 Protein [orb2995243]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)

    Predicted: 16.7 KDa. Observed: 15 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • CD210b Mouse Monoclonal Antibody [orb2988312]

    FC,  WB

    Human, Rat

    Mouse

    Monoclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
  • Mouse IL-10/Interleukin-10 ELISA Kit [orb50056]

    Mouse

    15.6 pg/ml - 1,000 pg/ml

    <1 pg/ml

    96 T
  • Recombinant mouse IL-10 protein, N-His (HEK293) [orb1516603]

    >90% as determined by SDS-PAGE

    20.6 kDa

    100 μg, 500 μg, 20 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry