Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)

SKU: orb2986597

Description

This Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active) spans the amino acid sequence from region 56-182aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cancer Biology; Immunology & Inflammation; Cell Biology

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF10B at 2 μg/mL can bind Anti-TNFRSF10B recombinant antibody. The EC50 is 1.880-2.195 ng/mL.
• Tag: C-terminal 10xHis-tagged
• Molecular Weight: 15.7 kDa
• Expression Region: 56-182aa
• Protein Length: Partial
• Protein Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2 (TRAIL receptor 2; TRAIL-R2); CD262; TNFRSF10B; DR5, KILLER, TRAILR2, TRICK2, ZTNFR9; UNQ160/PRO186

Quick Database Links

UniProt

O14763