Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)

SKU: orb2986409

Description

This Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active) spans the amino acid sequence from region 105-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/mL can bind Human TNFRSF17 protein. The EC50 is 0.8083-0.9391 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL.
• Tag: N-terminal hFc-tagged
• Molecular Weight: 42.6 kDa
• Expression Region: 105-250aa
• Protein Length: Full Length of Mature Protein of Isoform Alpha
• Protein Sequence: AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Disclaimer: For research use only

Alternative Names

Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand (APRIL); TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2); TNF-related death ligand 1 (TRDL-1); CD256; TNFSF13; APRIL, TALL2, ZTNF2; UNQ383/PRO715

Quick Database Links

UniProt

O75888