You have no items in your shopping cart.
Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)
SKU: orb2985998
Active
Description
Research Area
Cancer Biology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFRSF17 recombinant antibody at 2 μg/mL can bind Human TNFRSF17 protein. The EC50 is 1.745-1.901 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13B protein at 2 μg/mL can bind Human TNFRSF17 protein. The EC50 is 2.232-2.579 ng/mL. |
| Tag | C-terminal mFc-tagged |
| Molecular Weight | 35.2 kDa |
| Expression Region | 1-54aa |
| Protein Length | Partial |
| Protein Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Purity | Greater than 95% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−B-cell maturation protein (CD_antigen: CD269) (BCM) (BCMA)
Similar Products
−Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active) [orb3053855]
Greater than 95% as determined by SDS-PAGE.
7.6 kDa
Mammalian cell
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active) (orb2985998)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review