You have no items in your shopping cart.
Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL on streptavidin coated plates can bind Anti-TNFSF15 antibody. The EC50 is 0.2732 - 0.6370 ng/mL. |
| Tag | N-terminal 10xHis-Avi-tagged |
| Molecular Weight | 25.4 kDa |
| Expression Region | 72-251aa |
| Protein Length | Partial of Isoform 1 |
| Protein Sequence | LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/ml on streptavidin coated plates can bind Anti-TNFSF15 antibody. The EC50 is 0.2732 - 0.6370 ng/mL.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active) (orb2280208)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review