You have no items in your shopping cart.
Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml. |
| Tag | C-terminal hFc1-Flag-tagged |
| Expression Region | 22-401aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 73.5 kDa |
| Purity | Greater than 93.6% as determined by SDS-PAGE. |
| Protein Sequence | ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein(TNFRSF11B) (Active) [orb1650510]
>95% as determined by SDS-PAGE and HPLC.
19.7 kDa
50 μg, 100 μg, 500 μg, 1 mg, 10 μg, 250 μgRecombinant Human Tumor necrosis factor receptor superfamily member 11B protein(TNFRSF11B) (Active) [orb1650511]
>95% as determined by SDS-PAGE and HPLC.
109.6 kDa
50 μg, 100 μg, 500 μg, 1 mg, 10 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active) (orb1095898)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review