You have no items in your shopping cart.
Recombinant Human Transforming Growth Factor - alpha
SKU: orb1906261
Featured
Active
Description
Research Area
Stem Cell & Developmental Biology
Images & Validation
−
Key Properties
−| Source | Escherichia coli |
|---|---|
| Expression System | Escherichia coli |
| Biological Activity | Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1-0.4 ng/ml. |
| Endotoxins | Less than 0.1 EU/ug of rHuTGF-α as determined by LAL method. |
| MW | Approximately 6 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids. |
| Purity | >95% by SDS-PAGE analyses. |
| Protein Sequence | MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
Storage & Handling
−| Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
|---|---|
| Form/Appearance | Lyophilized from 0.2 μm filtered concentrated solution in Acetonitrile and TFA. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Recombinant Human Transforming Growth Factor - alpha (orb1906261)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review