Recombinant Human Transforming Growth Factor - alpha

SKU: orb1906261

Description

Recombinant Human Transforming Growth Factor - alpha

Research Area

Stem Cell & Developmental Biology

Key Properties

• Source: Escherichia coli
• Expression System: Escherichia coli
• Biological Activity: Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1-0.4 ng/ml.
• Molecular Weight: Approximately 6 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.
• Protein Sequence: MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
• Purity: >95% by SDS-PAGE analyses.
• Endotoxins: Less than 0.1 EU/ug of rHuTGF-α as determined by LAL method.

Storage & Handling

• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.
• Form/Appearance: Lyophilized from 0.2 μm filtered concentrated solution in Acetonitrile and TFA.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only