You have no items in your shopping cart.
Recombinant Human Serine/threonine-protein kinase receptor R3 (ACVRL1), partial (Active)
SKU: orb1882059
Featured
Active
Description
Research Area
Pharmacology & Drug Discovery
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Baculovirus |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody, the EC50 is 2.417-2.971 ng/mL. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 22-118aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 11.5 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ACVRLK1;ALK1;

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

