You have no items in your shopping cart.
Recombinant Human Novel Coronavirus Spike glycoprotein(S)(K417N,E484K,N501Y),partial
SKU: orb1096686
Featured
Description
Research Area
Cancer Biology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 319-541aa(K417T) |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| MW | 27.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(S glycoprotein)(Peplomer protein)(Spike protein S1)(Spike protein S2)

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
