Recombinant Human Myosin regulatory light chain 12A (MYL12A)

• Catalog Number: orb2986403
• Category: Proteins
• Description: Recombinant Human Myosin regulatory light chain 12A (MYL12A)
• Tag: C-terminal 10xHis-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
• Protein Length: Full Length
• UniProt ID: P19105
• MW: 21.2 kDa
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Endotoxins: Not test
• Source: Baculovirus
• Biological Origin: Homo sapiens (Human)
• Expression Region: 1-171aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Alternative names: Epididymis secretory protein Li 24;HEL-S-24;MLC-2B
• Research Area: Signal Transduction
• Note: For research use only
• Expiration Date: 6 months from date of receipt.