You have no items in your shopping cart.
Recombinant Human Metalloproteinase inhibitor 1 (TIMP1)
SKU: orb3011439
Description
Research Area
Cancer Biology; Musculoskeletal & Connective Tissue Research; Pharmacology & Drug Discovery
Images & Validation
−
Key Properties
−| Expression System | Baculovirus |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 24-207 |
| Protein Length | 184 |
| Endotoxins | Not test |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA |
Storage & Handling
−| Storage | Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Metalloproteinase inhibitor 1; Erythroid-potentiating activity; EPA; Fibroblast collagenase inhibitor; Collagenase inhibitor; Tissue inhibitor of metalloproteinases 1; TIMP-1; TIMP1 CLGI TIMP
Similar Products
−- Item 1 of 4
Recombinant Human TIMP-1 Protein [orb2995067]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 21.75 KDa. Observed: 27 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 1
TIMP1 Rabbit Polyclonal Antibody [orb2955771]
ELISA, IHC, WB
Bovine, Human, Monkey
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg - Item 1 of 1
- Item 1 of 1
Recombinant human TIMP-1 protein, His (HEK293) [orb1516662]
>95% as determined by SDS-PAGE
30 kDa
100 μg, 500 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Lead Time: please enquire