Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)

SKU: orb2659145

Description

This Recombinant Human Lymphocyte antigen 6E (LY6E) spans the amino acid sequence from region 21-101aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  Read more...

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/mL can bind Anti-LY6E recombinant antibody. The EC50 is 2.483-3.282 ng/mL.
• Tag: N-terminal hFc-tagged
• Expression Region: 21-101aa
• Protein Length: Full Length of Mature Protein
• MW: 34.6 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Lymphocyte antigen 6E; Ly-6E;Retinoic acid-induced gene E protein (RIG-E); Stem cell antigen 2 (SCA-2); Thymic shared antigen 1 (TSA-1); LY6E; 9804, RIGE, SCA2, TSA1

Quick Database Links

UniProt

Q16553