Recombinant Human Interleukin-21 (IL21) (Active)

• Catalog Number: orb2657887
• Category: Proteins
• Description: Recombinant Human Interleukin-21 (IL21) (Active)
• Tag: C-terminal hFc1-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution containing PBS,5% mannitoland 0.01% Tween 80, pH 7.4
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Protein Length: Full Length of Mature Protein
• UniProt ID: Q9HBE4
• MW: 41.9 kDa
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Endotoxins: ≤10 EU/mg by the LAL method
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is ≤ 20 ng/mL.
• Expression Region: 25-162aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Alternative names: Interleukin-21; IL-21; Za11; IL21
• Note: For research use only