Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) (Active)

SKU: orb1785331

Description

This Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) spans the amino acid sequence from region 27-282aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Cancer Biology, Signal Transduction

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Human IGFBP7. The EC50 is 3.405-5.456 ng/mL.
• Tag: C-terminal hFc1-tagged
• Molecular Weight: 55.4 kDa
• Expression Region: 27-282aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
• Purity: Greater than 95% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Disclaimer: For research use only

Alternative Names

Insulin-like growth factor-binding protein 7; IBP-7; IGF-binding protein 7;IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor (TAF); IGFBP7;MAC25, PSF

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/ml can bind Human IGFBP7. The EC50 is 3.405-5.456 ng/mL.

Quick Database Links

UniProt

Q16270