You have no items in your shopping cart.
Description
Images & Validation
−
| Tested Applications | ELISA, WB |
|---|---|
| Application Notes |
Key Properties
−| Source | E.Coli |
|---|---|
| Reactivity | Human |
| Tag | N-terminal His-IF2DI Tag |
| Expression Region | 2-159aa |
| MW | 38.0 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE |
| Protein Sequence | AAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQK |
Storage & Handling
−| Storage | -20°C for 12 months as lyophilized; 2-8°C for 1 month under sterile conditions after reconstitution |
|---|---|
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution in 10 mM Hepes, 500 mM NaCl with 5% trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human HNRNPM Protein, N-His [orb2965098]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
26.27 kDa
1 mg, 50 μg, 100 μgRecombinant Human HNRNPM Protein, N-His [orb2833380]
>90% as determined by SDS-PAGE.
26.27 kDa
20 μg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Simona Marzano 1, Gabriella Pinto 2 3, Anna Di Porzio 1, Jussara Amato 4, Antonio Randazzo 1, Angela Amoresano 2 3, Bruno Pagano 5 Identifying G-quadruplex-interacting proteins in cancer-related gene promoters Commun Chem, (2025)
Recombinant Human HNRNPM (orb1784775)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

