Recombinant Human Histone H3.1 (H3C1)

SKU: orb2666516

Description

This Recombinant Human Histone H3.1 (H3C1) spans the amino acid sequence from region 2-136aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Epigenetics & Chromatin

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 10xHis-tagged
• Molecular Weight: 21.3 kDa
• Expression Region: 2-136aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Endotoxins: Not test

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Histone H3/a;Histone H3/b;Histone H3/c;Histone H3/d;Histone H3/f;Histone H3/h;Histone H3/i;Histone H3/j;Histone H3/k;Histone H3/l

Quick Database Links

UniProt

P68431