You have no items in your shopping cart.
Page Not Found
Cart summary
Item 1 of 1
Recombinant Human Growth/differentiation factor 5 (GDF5)
Catalog Number: orb2659167
| Catalog Number | orb2659167 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Growth/differentiation factor 5 (GDF5) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P43026 |
| MW | 20.5 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 382-501aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Alternative names | GDF-5;Bone morphogenetic protein 14;BMP-14;Cartila Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human GDF5 protein [orb705307]
> 95 % as determined by SDS-PAGE and HPLC analyses.
13.6 kDa
E.Coli
10 μg, 100 μg, 500 μg 
Human GDF5 protein [orb706947]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human GDF5 Protein, N-His [orb2821295]
> 90% as determined by SDS-PAGE.
15.89 kDa
100 μg, 50 μg, 20 μgHuman GDF5 protein [orb633456]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
34.5 KDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μgHuman GDF5 (His) Protein [orb425675]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 5 μg, 25 μg
