You have no items in your shopping cart.
Recombinant Human Fibroblast growth factor 4 (FGF4) (Active)
SKU: orb2657919
Featured
Active
Description
Research Area
Stem Cell & Developmental Biology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.25-1 ng/mL |
| Tag | Tag free |
| Expression Region | 31-206aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | ≤10 EU/mg by the LAL method |
| MW | 19.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3
Similar Products
−Recombinant human FGF4 protein (Active,CHO) [orb3124237]
≥ 95% as determined by SDS-PAGE.
19.3 kDa
10 μg, 50 μg, 500 μgRecombinant Human Fibroblast growth factor 4 protein(FGF4) (Active) [orb1650711]
>96% as determined by SDS?PAGE and HPLC.
19.8 kDa
5 μg, 1 mg, 500 μg, 250 μg, 100 μg, 25 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide