You have no items in your shopping cart.
Featured
Active
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured in a cell proliferation assay using Mv.1.Lu Mink lung epithelial cells. The ED50 for this effect is ≤10 ng/mL. |
| Tag | Tag free |
| Expression Region | 32-194aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | ≤10 EU/mg by the LAL method |
| MW | 18.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast growth factor 7; FGF-7; Heparin-binding growth factor 7; HBGF-7; Keratinocyte growth factor; FGF7; KGF
Similar Products
−Human FGF7 protein (Active) [orb359153]
> 96% as determined by SDS-PAGE and HPLC.
18.9 kDa
E.Coli
500 μg, 100 μg, 10 μgRecombinant human FGF-7/KGF protein (Active, CHO) [orb3124180]
≥ 95% as determined by SDS-PAGE.
18.8 kDa
10 μg, 50 μg, 500 μgRecombinant Human Fibroblast growth factor 7 protein(FGF7) (Active) [orb1650710]
>96% as determined by SDS-PAGE and HPLC.
18.9 kDa
1 mg, 500 μg, 250 μg, 100 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
