Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Human Fibroblast growth factor 1 protein(FGF1) (Active)

SKU: orb1650719
ActiveBiologically Active

Description

Recombinant Human Fibroblast growth factor 1 protein(FGF1) (Active)

Research Area

Cardiovascular Research; Stem Cell & Developmental Biology

Images & Validation

Key Properties

Expression SystemE.Coli
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb,c 3T3 cells is less than 0.5 ng,ml, corresponding to a specific activity of 2.0 106 IU,mg in the presence of 10 g,ml of heparin.
TagNO-tagged
MW16.0 kDa
Purity>95% as determined by SDS-PAGE and HPLC.
Protein SequenceM+FNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance0.2 ?m filtered PBS, pH 7.4 ,lyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FGF-1, aFGF, Endothelial cell growth factor, ECGF, Heparin-binding growth factor 1

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Recombinant Human Fibroblast growth factor 1 protein(FGF1) (Active) (orb1650719)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 210.00
50 μg
$ 450.00
100 μg
$ 780.00
250 μg
$ 1,320.00
500 μg
$ 1,710.00
1 mg
$ 2,310.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry