Recombinant Human Claudin-4 (CLDN4)-Detergent

SKU: orb2986522

Description

This Recombinant Human Claudin-4 (CLDN4)-Detergent spans the amino acid sequence from region 1-209aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cancer Biology

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged
• Expression Region: 1-209aa
• Protein Length: Full Length
• MW: 26.6 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Liquid
• Buffer/Preservatives: 50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH 7.5
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Clostridium perfringens enterotoxin receptor;CPE-R;CPE-receptor;Williams-Beuren syndrome chromosomal region 8 protein

Quick Database Links

UniProt

O14493