Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

SKU: orb2986827
ActiveBiologically Active

Description

This Recombinant Human CD79A&CD79B Heterodimer Protein (Active) spans the amino acid sequence from region 33-143aa&29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceMammalian cell
Biological OriginHomo sapiens (Human)
Biological Activity①Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody. The EC50 is 8.012-9.339 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody. The EC50 is 14.85-17.47 ng/mL.
TagC-terminal mFc-Flag-tagged&C-terminal 10xHis-mFC-tagged
Expression Region33-143aa&29-159aa
Protein LengthHeterodimer
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.
MW41.3 kDa&43.1 kDa
PurityGreater than 90% as determined by SDS-PAGE.
Protein SequenceLWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

20 μg
$ 240.00
100 μg
$ 430.00
1 mg
$ 2,960.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry