You have no items in your shopping cart.
Cart summary
Item 1 of 1
Recombinant Human C-C motif chemokine 16 (CCL16)
Catalog Number: orb1096113
| Catalog Number | orb1096113 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human C-C motif chemokine 16(CCL16) |
| Tag | N-terminal 10xHis-HA-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 13.8 kDa |
| UniProt ID | O15467 |
| Protein Sequence | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 24-120aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Chemokine CC-4 , HCC-4, Chemokine LEC, IL-10-induc Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human CCL16 protein [orb244076]
Greater than 90% as determined by SDS-PAGE.
27.2 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human CCL16 Protein [orb1471709]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
11 KDa
Mammalian
50 μg, 10 μg 
Human CCL16 protein [orb391362]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human C-C motif chemokine 16 protein(CCL16) (Active) [orb1650819]
5 μg, 20 μg, 100 μg, 250 μg, 1 mg, 500 μg
